PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s874851g004
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family HD-ZIP
Protein Properties Length: 774aa    MW: 85347.9 Da    PI: 5.6617
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s874851g004genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.91.9e-1964119156
                        TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++ +++t eq++eLe+lF++ ++p++++r eL+ +l+L+ rqVk+WFqNrR++ k
  PDK_30s874851g004  64 KKRYHRHTVEQIQELEALFKEYPHPNEKQRLELSIQLSLDPRQVKFWFQNRRTQLK 119
                        688899**********************************************9987 PP

2START32.42.1e-11274351169
                        HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCG CS
              START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddk 69 
                        ela++a++elv++a++eep+Wv s     e++n+de+ + f++  +     + +ea r+s+vv+ ++  lve+l+d +
  PDK_30s874851g004 274 ELALAAMEELVQMAQLEEPLWVPSLeggkEMLNYDEYHRVFPRIIGvkpigYVSEATRESKVVIINSQVLVETLMDAM 351
                        5899*************************************998779*****************************98 PP

3START836.8e-2735150494206
                        EEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCE...................... CS
              START  94 mvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksngh...................... 161
                        m aelq+lsplvp R   f+Ry++q+ + +w++vdvS+ds+++ p     ++ +++lpSg+l++ ++ng+                      
  PDK_30s874851g004 351 MHAELQVLSPLVPiRSINFLRYSKQQAQNVWAVVDVSIDSDKNYPPsPGTYMSSRRLPSGCLVQNMPNGYskyqtwelimklwekviehelk 442
                        789*************************************9998884556999*************************************** PP

                        .................EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
              START 162 .................skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                                          +vtwveh++++++ +h l+r++++sgla ga  wv+ l+r ce+
  PDK_30s874851g004 443 ceaklleyllsgsflasNEVTWVEHTEYDESGVHPLYRRMLRSGLALGAGSWVSNLHRRCEC 504
                        ****************889*****************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-1952115IPR009057Homeodomain-like
SuperFamilySSF466891.54E-1953121IPR009057Homeodomain-like
PROSITE profilePS5007117.5461121IPR001356Homeobox domain
SMARTSM003894.8E-1862125IPR001356Homeobox domain
CDDcd000865.63E-1864121No hitNo description
PfamPF000467.0E-1764119IPR001356Homeobox domain
PROSITE patternPS00027096119IPR017970Homeobox, conserved site
PROSITE profilePS5084823.991265507IPR002913START domain
CDDcd088751.01E-76271503No hitNo description
SuperFamilySSF559613.96E-18272419No hitNo description
SMARTSM002341.6E-8274504IPR002913START domain
PfamPF018522.1E-21351504IPR002913START domain
SuperFamilySSF559613.96E-18459504No hitNo description
SuperFamilySSF559617.22E-16524702No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 774 aa     Download sequence    Send to blast
MEKTNMEGQG EISQLGVIGG EGDGSRDKDS MSRNREDENT SNLETNSLEE ISSDDLDQEN  60
PRKKKRYHRH TVEQIQELEA LFKEYPHPNE KQRLELSIQL SLDPRQVKFW FQNRRTQLKT  120
QIERHENSIL RQDNEKLKSE NMTIREAMMN PRCNTCGGPA ILGEVSLEEQ NMRIENARLK  180
DELNRVSSLA KKFLGRAMSS LDNPVPPTML NSALELAIGN NSFSGLDMIP TLPTMPAFVS  240
GASNPLVSIA TPSARNYGVL GDADKSNERY VLLELALAAM EELVQMAQLE EPLWVPSLEG  300
GKEMLNYDEY HRVFPRIIGV KPIGYVSEAT RESKVVIINS QVLVETLMDA MHAELQVLSP  360
LVPIRSINFL RYSKQQAQNV WAVVDVSIDS DKNYPPSPGT YMSSRRLPSG CLVQNMPNGY  420
SKYQTWELIM KLWEKVIEHE LKCEAKLLEY LLSGSFLASN EVTWVEHTEY DESGVHPLYR  480
RMLRSGLALG AGSWVSNLHR RCECVANLIS SFTTDEHSAI SMAGKRSMMK LARRMTDNFC  540
SGVCAWATHN WRQLTAGTFG EDVRVMTRKS VNNPGEPQGV VLGAATSVPV PVPPQRLFDF  600
LRDGRRRGEW DILSNGGRMH EVLHVAKGHD AANAVSLLRP TVVGASETSM LILQDTFTDA  660
STALVVYAPV DLSAIHVVMN GGDPGYVALL PSGFAILPDG SGSPAATARS GAGEAAASPT  720
GGSLLTAGFQ ILVSSIPTAN PTQDSVETVI NLMSCTIQNI KTAVHCENGV CFGG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010934555.10.0PREDICTED: homeobox-leucine zipper protein ROC5-like
SwissprotQ6EPF00.0ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLA0A0S3RT530.0A0A0S3RT53_PHAAN; Uncharacterized protein
STRINGVIT_15s0048g02000.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1